General Information

  • ID:  hor006208
  • Uniprot ID:  P41319
  • Protein name:  C-type natriuretic peptide
  • Gene name:  NA
  • Organism:  Squalus acanthias (Spiny dogfish)
  • Family:  Natriuretic peptide family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Squalus (genus), Squalidae (family), Squaliformes (order), Squalomorphii , Selachii (infraclass), Elasmobranchii (subclass), Chondrichthyes (class), Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0006182 cGMP biosynthetic process; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GPSRSCFGLKLDRIGAMSGLGC
  • Length:  22
  • Propeptide:  MSGHTSFYCGLLLLLLIQVQARPRADDSLQVLSRLLEDEYGHFNSEELNNEAQEISPAASLPDLNTDQSDLELPWDRESREIGGRSFRQEALLARLLQDLSNNPLRFKGRSKKGPSRSCFGLKLDRIGAMSGLGC
  • Signal peptide:  MSGHTSFYCGLLLLLLIQVQARPRA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Hormone which may be vasoactive and natriuretic. Has a cGMP-stimulating activity (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  6-22
  • Structure ID:  AF-P41319-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006208_AF2.pdbhor006208_ESM.pdb

Physical Information

Mass: 260039 Formula: C93H157N29O28S3
Absent amino acids: EHNQTVWY Common amino acids: G
pI: 8.83 Basic residues: 3
Polar residues: 10 Hydrophobic residues: 6
Hydrophobicity: 22.73 Boman Index: -2023
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 75.45
Instability Index: 6681.36 Extinction Coefficient cystines: 125
Absorbance 280nm: 5.95

Literature

  • PubMed ID:  1928383
  • Title:  Identification of C-type natriuretic peptide in heart of spiny dogfish shark (Squalus acanthias).